| Molekylformel | C₂₀₅H₃₄₀N₆₀O₅₃ |
| Molekylvikt | 4493.37 g/mol |
| CAS-nummer | 154947-66-7 |
| Aminosyrasekvens | [LL-37, 37 aa] |
| Antal aminosyror | 37 |
| Renhet | ≥99% (HPLC) |
| Utseende / Form | Vitt frystorkat pulver |
| Rekonstituering | Bakteriostatiskt vatten |
| Förvaring | −20 °C, skyddad från ljus; undvik frys-tiocykler |
Byggt på bevis, inte på löften
Verifierad renhet
Varje batch oberoende testad av Janoshik. COA publicerat, inte lovat.
Leverans samma dag
Beställ före 15:00 och din beställning skickas samma arbetsdag från Nederländerna.
Diskret och skyddat
Neutral förpackning, temperaturkontrollerad hantering och fullt spårad leverans.
Renhetgaranti
99% eller mer, eller pengarna tillbaka. Tydligt angivet eftersom vi står bakom det.
Forskning & Utveckling
Varje produkt vi tillverkar uppfyller tre grundläggande principer — utan undantag.
-
Vetenskapligt Underlag — kliniskt underbyggd
-
Relevans — verksam för ditt syfte
-
Säkerhet & Kvalitet — GMP testad
Peptide reconstitution calculator
Calculate the volume corresponding to a specified peptide amount for research purposes, based on vial, solvent and syringe scale.
What is your syringe volume?
Peptide amount in the vial
Desired peptide amount
Bacteriostatic water
Result
⚠ The syringe volume is not sufficient for this amount.
For research purposes only. Not for human consumption.