| Molecular Formula | C₂₀₅H₃₄₀N₆₀O₅₃ |
| Molecular Weight | 4493.37 g/mol |
| CAS Number | 154947-66-7 |
| Amino Acid Sequence | [LL-37, 37 aa] |
| Number of Amino Acids | 37 |
| Purity | ≥99% (HPLC) |
| Appearance / Form | Wit gevriesdroogd poeder |
| Reconstitution | Bacteriostatisch water |
| Storage | −20 °C, beschermd tegen licht; vries-dooicycli vermijden |
Built on evidence, not promises
Verified Purity
Every batch independently tested by Janoshik. COA published, not promised.
Same-Day Shipping
Order before 15:00 and your order will be shipped the same business day from the Netherlands.
Discreet & Protected
Neutral packaging, temperature-controlled handling, and fully tracked delivery.
Purity Guarantee
99% purity or higher, or your money back. Clearly stated because we stand behind it.
Waarvoor wordt LL37 onderzocht?
Research & Development
Every product we create follows three fundamental principles — without exception.
-
Scientific Evidence — Clinically supported
-
Relevance — Effective for your goal
-
Safety & Quality — GMP tested
Peptide reconstitution calculator
Calculate the volume corresponding to a specified peptide amount for research purposes, based on vial, solvent and syringe scale.
What is your syringe volume?
Peptide amount in the vial
Desired peptide amount
Bacteriostatic water
Result
⚠ The syringe volume is not sufficient for this amount.
For research purposes only. Not for human consumption.





