LL-37
LL-37
Wordt onderzocht in relatie tot het immuunsysteem.
Wordt onderzocht in relatie tot wond- en weefselgerelateerde processen.
In stock and ready to ship
Bacteriostatic Water (BAC Water)
Insuline Needles
Prefilled
Your selected peptide is pre-filled into a pen by us and delivered chilled.
Couldn't load pickup availability
LL-37 is a human cathelicidin peptide that is studied as a proteolytic derivative of hCAP18 and is expressed in epithelial tissues and immune cells. It exhibits broad-spectrum antimicrobial activity and functions as a modulator of innate immune responses. It is also studied in relation to wound healing, angiogenesis, epithelial repair, and inflammatory regulation.
Product Name
LL-37
Physical Appearance
Fine lyophilized powder (white to off-white in appearance)
Molecular Formula
C₂₀₅H₃₄₀N₆₀O₅₃
Molecular Weight
~4493.3 g/mol
Storage Conditions
Store refrigerated (2–8 °C). Protect from light and moisture.
For research purposes only. Not for human consumption.
Quality & Testing
Quality & Testing
Each batch is independently tested by a certified third-party laboratory to verify purity, identity, and composition. Every analysis is performed using advanced methods such as HPLC and mass spectrometry, ensuring the highest research quality.
Verified Purity: Every batch is tested for peptide integrity and composition.
Third-Party Certified: Analysis is conducted by accredited laboratories using validated testing procedures.
Transparent Results: The corresponding Certificate of Analysis (COA) and analytical data can be viewed in the product images above.
All products from My Peptides Lab undergo strict processing, temperature control, and documentation procedures to ensure consistency and traceability from production to shipment.
LL-37
| Molecular Formula | C₂₀₅H₃₄₀N₆₀O₅₃ |
| Molecular Weight | 4493.37 g/mol |
| CAS Number | 154947-66-7 |
| Amino Acid Sequence | [LL-37, 37 aa] |
| Number of Amino Acids | 37 |
| Purity | ≥99% (HPLC) |
| Appearance / Form | Wit gevriesdroogd poeder |
| Reconstitution | Bacteriostatisch water |
| Storage | −20 °C, beschermd tegen licht; vries-dooicycli vermijden |
Built on evidence, not promises
Verified Purity
Every batch independently tested by Janoshik. COA published, not promised.
Same-Day Shipping
Order before 15:00 and your order will be shipped the same business day from the Netherlands.
Discreet & Protected
Neutral packaging, temperature-controlled handling, and fully tracked delivery.
Purity Guarantee
99% purity or higher, or your money back. Clearly stated because we stand behind it.
Waarvoor wordt LL37 onderzocht?
Antimicrobiële afweer
Wondgenezing en weefselherstel
Huidbarrière en ontsteking
Immuunmodulatie
Geavanceerd therapeutisch onderzoek
Langdurige weefselondersteuning
Research & Development
Every product we create follows three fundamental principles — without exception.
-
Scientific Evidence — Clinically supported
-
Relevance — Effective for your goal
-
Safety & Quality — GMP tested
Peptide reconstitution calculator
Calculate the volume corresponding to a specified peptide amount for research purposes, based on vial, solvent and syringe scale.
What is your syringe volume?
Peptide amount in the vial
Desired peptide amount
Bacteriostatic water
Result
⚠ The syringe volume is not sufficient for this amount.
For research purposes only. Not for human consumption.
