LL-37
Recovery- 1 × LL-37 5MG€74,99
- 1 × Bacteriostatic Water€9,95
- 1 × Needles · 5 needles€4,95
CryptoFor research use only. Not for human consumption. These products are intended for laboratory research and are not drugs, foods, or cosmetics.
About LL-37
For research purposes only. Not for human consumption.
Quality & Testing
Every batch is independently tested by a certified external laboratory to verify purity, identity, and composition. Each analysis uses advanced methods such as HPLC and mass spectrometry, guaranteeing the highest research quality.
- Verified purity: every batch is tested for peptide integrity and composition.
- Third-party certified: analysis is performed by accredited laboratories using validated testing procedures.
- Transparent results: the corresponding Certificate of Analysis (COA) and analytical data are on our Lab Results page.
All My Peptides Lab products undergo strict processing, temperature control, and documentation to guarantee consistency and traceability from production to shipment.
Peptide specifications
- Molecular formula
- C₂₀₅H₃₄₀N₆₀O₅₃
- Molecular weight
- 4493.37 g/mol
- CAS number
- 154947-66-7
- Amino acid sequence
- [LL-37, 37 aa]
- Number of amino acids
- 37
- Purity
- ≥99% (HPLC)
- Appearance / form
- White lyophilized powder
- Reconstitution
- Bacteriostatic water
- Storage
- −20 °C, protected from light; avoid freeze-thaw cycles
- Freeze-thaw cycles
- Avoid repeated cycles
- Shipping
- Ships in 24 hours
- Research use
- In vitro only
Important questions answered by professionals
*Answered by independent medical researchers and licensed physicians
What is LL-37 as a research peptide?
LL-37 is a human peptide from the cathelicidin family and corresponds to the 134-170 segment of the human cationic protein 18 (hCAP18). It is a peptide of 37 amino acids. LL-37 is sold by MyPeptidesLab strictly for in-vitro research and is not approved by the EMA, FDA or any national medicines authority.
What is LL-37 being studied for in research?
In preclinical and in-vitro studies, LL-37 is being researched in relation to immune defence processes, inflammatory processes and tissue repair. Research also focuses on the modulation of immune cells in study models. Research findings are preliminary and require further validation.
What is included in the Certificate of Analysis (CoA) for LL-37?
The batch-specific CoA for LL-37 shows an HPLC purity of 99% or higher, identity confirmation by mass spectrometry, the batch number and the net peptide content in milligrams per vial. The CoA is published on the product page, so you can review it before ordering.
How do you verify the purity of your peptides?
Every batch is HPLC-tested by an independent external laboratory for a purity of 99% or higher, with identity confirmation by mass spectrometry. The batch-specific Certificate of Analysis is published on every product page.
How quickly is my order delivered and which carriers do you use?
Orders placed before 15:00 CET are shipped the same business day from the Netherlands via PostNL, including on Saturdays. Delivery within the EU typically takes 2–5 business days, fully tracked. Every package is shipped in neutral, unbranded packaging with no visible references to peptides.
Does MyPeptidesLab offer bulk or wholesale orders for peptides?
Yes, we supply bulk and wholesale quantities to verified research facilities. For inquiries, you can send an email to support@mypeptideslab.com with your specifications.
